PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01745.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 480aa    MW: 52184.4 Da    PI: 10.2076
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01745.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.48.7e-10163196135
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgR 35 
                                   +g+WT+eEd+llvd+++  G g+W++ ++  g  +
  Zmw_sc01745.1.g00030.1.am.mk 163 KGPWTPEEDKLLVDYIQANGHGSWRLLPKLAG-LL 196
                                   79***************************999.33 PP

2Myb_DNA-binding27.28.9e-092132372348
                                   -HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  23 tWktIartmgkgRtlkqcksrwqkyl 48 
                                   +W+ Ia+ ++ gRt++++k++w+++l
  Zmw_sc01745.1.g00030.1.am.mk 213 RWSMIAAQLP-GRTDNEIKNYWNTHL 237
                                   5*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.952158241IPR017930Myb domain
SuperFamilySSF466894.79E-13160233IPR009057Homeodomain-like
SMARTSM007175.3E-14162239IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-9162193IPR009057Homeodomain-like
PfamPF002492.2E-7163194IPR001005SANT/Myb domain
CDDcd001672.82E-10165237No hitNo description
PfamPF002493.6E-6212237IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-13212238IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MEAENAAKIA DSPASYELSQ VRIYSSLRPL RIRARPGRAP LHLSLGPLHA LSSVVPSQAA  60
GGESPALKSA RKILLGRKHD PPRRPRARLS VSRPNLSLPF HFSNQSQACS RRASSCSRAW  120
RQRVITSFSV RAEREKRVGT GGSRRRRPMG RAPCCDKKQG LTKGPWTPEE DKLLVDYIQA  180
NGHGSWRLLP KLAGLLDLKS FQYALLFVPL CGRWSMIAAQ LPGRTDNEIK NYWNTHLKKQ  240
LRRMGLDDPP PGPASGSPAA RHMAQWETAR LEAEARLSLL AAASSASGAA TATTTTTSAS  300
SSSTVGAVCD APADIYLRLW SSDIGDSFRK VEKAAESPPV SVKKKDAVTI KQEGQALAGD  360
DSSAASNEVD VAMALEEYQM FLDLAGEELG MFHGRYGDLS MFDMLTEAPL AAAFKAFGAE  420
LELIVLSLKS FQHLRLPVAS WQQTQHREAA WSSSARPCAN ANHCFSELLN ATAHARLLGA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001148496.11e-105P-type R2R3 Myb protein
TrEMBLC0PCI61e-109C0PCI6_MAIZE; MYB transcription factor
STRINGGRMZM2G040924_P011e-108(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157